Lineage for d3ximb_ (3xim B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19614Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) (S)
  5. 19635Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 19636Protein D-xylose isomerase [51666] (12 species)
  7. 19637Species Actinoplanes missouriensis [TaxId:1866] [51673] (14 PDB entries)
  8. 19643Domain d3ximb_: 3xim B: [29478]

Details for d3ximb_

PDB Entry: 3xim (more details), 2.3 Å

PDB Description: arginine residues as stabilizing elements in proteins

SCOP Domain Sequences for d3ximb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ximb_ c.1.15.3 (B:) D-xylose isomerase {Actinoplanes missouriensis}
vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
kpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklf
hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
gvwesaranirmylllrerarafradpevqealaaskvaelktptlnpgegyaelladrs
afedydadavgakgfgfvklnqlaiehllgar

SCOP Domain Coordinates for d3ximb_:

Click to download the PDB-style file with coordinates for d3ximb_.
(The format of our PDB-style files is described here.)

Timeline for d3ximb_: