Lineage for d3qf2b_ (3qf2 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719058Family a.77.1.0: automated matches [254238] (1 protein)
    not a true family
  6. 2719059Protein automated matches [254542] (3 species)
    not a true protein
  7. 2719065Species Human (Homo sapiens) [TaxId:9606] [255408] (6 PDB entries)
  8. 2719068Domain d3qf2b_: 3qf2 B: [294697]
    automated match to d3qf2a_

Details for d3qf2b_

PDB Entry: 3qf2 (more details), 1.7 Å

PDB Description: Crystal structure of NALP3 PYD
PDB Compounds: (B:) NACHT, LRR and PYD domains-containing protein 3

SCOPe Domain Sequences for d3qf2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qf2b_ a.77.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
strcklaryledledvdlkkfkmhledyppqkgciplprgqtekadhvdlatlmidfnge
ekawamavwifaainrrdlyekakrdepkwgsdnarvsnptvicqe

SCOPe Domain Coordinates for d3qf2b_:

Click to download the PDB-style file with coordinates for d3qf2b_.
(The format of our PDB-style files is described here.)

Timeline for d3qf2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3qf2a_