Lineage for d5xiaa_ (5xia A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2088890Family c.1.15.3: Xylose isomerase [51665] (2 protein domains)
  6. 2088891Protein D-xylose isomerase [51666] (13 species)
  7. 2088949Species Arthrobacter, strain b3728 [TaxId:1663] [51672] (17 PDB entries)
  8. 2088954Domain d5xiaa_: 5xia A: [29457]
    complexed with mg, xyl

Details for d5xiaa_

PDB Entry: 5xia (more details), 2.5 Å

PDB Description: structures of d-xylose isomerase from arthrobacter strain b3728 containing the inhibitors xylitol and d-sorbitol at 2.5 angstroms and 2.3 angstroms resolution, respectively
PDB Compounds: (A:) d-xylose isomerase

SCOPe Domain Sequences for d5xiaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xiaa_ c.1.15.3 (A:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]}
vqptpadhftfglwtvgwtgadpfgvatranldpveavhklaelgaygitfhdndlipfd
ataaerekilgdfnqaladtglkvpmvttnlfshpvfkdggftsndrsirrfalakvlhn
idlaaemgaetfvmwggregseydgskdlaaaldrmregvdtaagyikdkgynlrialep
kpneprgdiflptvghglafieqlehgdivglnpetgheqmaglnfthgiaqalwaeklf
hidlngqrgikydqdlvfghgdltsafftvdllengfpnggpkytgprhfdykpsrtdgy
dgvwdsakanmsmylllkeralafradpevqeamktsgvfelgettlnagesaadlmnds
asfagfdaeaaaernfafirlnqlaiehllgsr

SCOPe Domain Coordinates for d5xiaa_:

Click to download the PDB-style file with coordinates for d5xiaa_.
(The format of our PDB-style files is described here.)

Timeline for d5xiaa_: