![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) ![]() different families share similar but non-identical metal-binding sites |
![]() | Family c.1.15.3: Xylose isomerase [51665] (2 proteins) |
![]() | Protein D-xylose isomerase [51666] (13 species) |
![]() | Species Arthrobacter, strain b3728 [TaxId:1663] [51672] (17 PDB entries) |
![]() | Domain d1xlhb_: 1xlh B: [29454] complexed with al |
PDB Entry: 1xlh (more details), 2.5 Å
SCOPe Domain Sequences for d1xlhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xlhb_ c.1.15.3 (B:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]} vqptpadhftfglwtvgwtgadpfgvatrknldpveavhklaelgaygitfhdndlipfd ateaerekilgdfnqalkdtglkvpmvttnlfshpvfkdggftsndrsirrfalakvlhn idlaaemgaetfvmwggregseydgskdlaaaldrmregvdtaagyikdkgynlrialep kpneprgdiflptvghglafieqlehgdivglnpetgheqmaglnfthgiaqalwaeklf hidlngqrgikydqdlvfghgdltsafftvdllengfpnggpkytgprhfdykpsrtdgy dgvwdsakanmsmylllkeralafradpevqeamktsgvfelgettlnagesaadlmnds asfagfdaeaaaernfafirlnqlaiehllgsr
Timeline for d1xlhb_: