Lineage for d1clka_ (1clk A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19614Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) (S)
  5. 19635Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 19636Protein D-xylose isomerase [51666] (12 species)
  7. 19741Species Streptomyces diastaticus, M1033 [TaxId:1956] [51671] (2 PDB entries)
  8. 19744Domain d1clka_: 1clk A: [29438]

Details for d1clka_

PDB Entry: 1clk (more details), 1.9 Å

PDB Description: crystal structure of streptomyces diastaticus no.7 strain m1033 xylose isomerase at 1.9 a resolution with pseudo-i222 space group

SCOP Domain Sequences for d1clka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clka_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces diastaticus, M1033}
syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
gatdseraehikrfrqaldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
pdaaaargmaferldqlamdhllgarg

SCOP Domain Coordinates for d1clka_:

Click to download the PDB-style file with coordinates for d1clka_.
(The format of our PDB-style files is described here.)

Timeline for d1clka_: