Lineage for d1qt1b_ (1qt1 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101025Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2101076Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2101077Protein D-xylose isomerase [51666] (13 species)
  7. 2101182Species Streptomyces diastaticus, M1033 [TaxId:1956] [51671] (2 PDB entries)
  8. 2101184Domain d1qt1b_: 1qt1 B: [29437]
    complexed with co

Details for d1qt1b_

PDB Entry: 1qt1 (more details), 1.85 Å

PDB Description: crystal structure of xylose isomerase from streptomyces diastaticus no.7 m1033 at 1.85 a resolution
PDB Compounds: (B:) protein (xylose isomerase)

SCOPe Domain Sequences for d1qt1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qt1b_ c.1.15.3 (B:) D-xylose isomerase {Streptomyces diastaticus, M1033 [TaxId: 1956]}
syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
gatdseraehikrfrqgldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
pdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d1qt1b_:

Click to download the PDB-style file with coordinates for d1qt1b_.
(The format of our PDB-style files is described here.)

Timeline for d1qt1b_: