Lineage for d1qt1b_ (1qt1 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19614Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) (S)
  5. 19635Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 19636Protein D-xylose isomerase [51666] (12 species)
  7. 19741Species Streptomyces diastaticus, M1033 [TaxId:1956] [51671] (2 PDB entries)
  8. 19743Domain d1qt1b_: 1qt1 B: [29437]

Details for d1qt1b_

PDB Entry: 1qt1 (more details), 1.85 Å

PDB Description: crystal structure of xylose isomerase from streptomyces diastaticus no.7 m1033 at 1.85 a resolution

SCOP Domain Sequences for d1qt1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qt1b_ c.1.15.3 (B:) D-xylose isomerase {Streptomyces diastaticus, M1033}
syqptpedkftfglwtvgwqgrdpfgdatrgaldpaesvrrlaelgahgvtfhdddlipf
gatdseraehikrfrqgldetgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaqtyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtpfaie
pkpneprgdillptighalafidglerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqsgikydqdlrfgpgdlraafwlvdllesagyegprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealraarldelaqptagdglqallpdrsafedfd
pdaaaargmaferldqlamdhllgarg

SCOP Domain Coordinates for d1qt1b_:

Click to download the PDB-style file with coordinates for d1qt1b_.
(The format of our PDB-style files is described here.)

Timeline for d1qt1b_: