Lineage for d8xia__ (8xia -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19614Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) (S)
  5. 19635Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 19636Protein D-xylose isomerase [51666] (12 species)
  7. 19761Species Streptomyces rubiginosus [TaxId:1929] [51670] (15 PDB entries)
  8. 19776Domain d8xia__: 8xia - [29435]

Details for d8xia__

PDB Entry: 8xia (more details), 1.9 Å

PDB Description: x-ray analysis of d-xylose isomerase at 1.9 angstroms: native enzyme in complex with substrate and with a mechanism-designed inactivator

SCOP Domain Sequences for d8xia__:

Sequence; same for both SEQRES and ATOM records: (download)

>d8xia__ c.1.15.3 (-) D-xylose isomerase {Streptomyces rubiginosus}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgar

SCOP Domain Coordinates for d8xia__:

Click to download the PDB-style file with coordinates for d8xia__.
(The format of our PDB-style files is described here.)

Timeline for d8xia__: