Lineage for d1xie__ (1xie -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19614Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) (S)
  5. 19635Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 19636Protein D-xylose isomerase [51666] (12 species)
  7. 19761Species Streptomyces rubiginosus [TaxId:1929] [51670] (15 PDB entries)
  8. 19774Domain d1xie__: 1xie - [29433]

Details for d1xie__

PDB Entry: 1xie (more details), 1.7 Å

PDB Description: modes of binding substrates and their analogues to the enzyme d-xylose isomerase

SCOP Domain Sequences for d1xie__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xie__ c.1.15.3 (-) D-xylose isomerase {Streptomyces rubiginosus}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgar

SCOP Domain Coordinates for d1xie__:

Click to download the PDB-style file with coordinates for d1xie__.
(The format of our PDB-style files is described here.)

Timeline for d1xie__: