Lineage for d1xis__ (1xis -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) 
Family c.1.15.3: Xylose isomerase [51665] (1 protein) Protein D-xylose isomerase [51666] (12 species) Species Streptomyces rubiginosus [TaxId:1929] [51670] (15 PDB entries) 
Domain d1xis__: 1xis - [29422]
Details for d1xis__
PDB Entry: 1xis (more details), 1.6 Å
PDB Description: a metal-mediated hydride shift mechanism for xylose isomerase based on the 1.6 angstroms streptomyces rubiginosus structures with xylitol and d-xylose
SCOP Domain Sequences for d1xis__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xis__ c.1.15.3 (-) D-xylose isomerase {Streptomyces rubiginosus}
nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllgarg
SCOP Domain Coordinates for d1xis__:
Click to download the PDB-style file with coordinates for d1xis__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xis__:
- d1xis__ appears in SCOP 1.57
- d1xis__ appears in the current release, SCOPe 2.08, called d1xisa_
View in 3D