![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) ![]() automatically mapped to Pfam PF04627 |
![]() | Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins) |
![]() | Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310956] (5 PDB entries) |
![]() | Domain d3oe7r_: 3oe7 R: [294209] Other proteins in same PDB: d3oe7d1, d3oe7d2, d3oe7d3, d3oe7e1, d3oe7e2, d3oe7e3, d3oe7f1, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7m1, d3oe7m2, d3oe7m3, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3 automated match to d2hldi_ complexed with anp, mg, po4; mutant |
PDB Entry: 3oe7 (more details), 3.19 Å
SCOPe Domain Sequences for d3oe7r_:
Sequence, based on SEQRES records: (download)
>d3oe7r_ a.137.8.1 (R:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} yaaylnvaaqairsslktelqtasvlnrsqtdafytqy
>d3oe7r_ a.137.8.1 (R:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} yaaylnvaaqairqtasvlnrsqtdafytqy
Timeline for d3oe7r_:
![]() Domains from other chains: (mouse over for more information) d3oe7d1, d3oe7d2, d3oe7d3, d3oe7e1, d3oe7e2, d3oe7e3, d3oe7f1, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m2, d3oe7m3, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3 |