Lineage for d3oe7i_ (3oe7 I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733879Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) (S)
    automatically mapped to Pfam PF04627
  5. 2733880Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)
  6. 2733881Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species)
  7. 2733882Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310956] (5 PDB entries)
  8. 2733888Domain d3oe7i_: 3oe7 I: [294208]
    Other proteins in same PDB: d3oe7d1, d3oe7d2, d3oe7d3, d3oe7e1, d3oe7e2, d3oe7e3, d3oe7f1, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7m1, d3oe7m2, d3oe7m3, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3
    automated match to d2hldi_
    complexed with anp, mg, po4; mutant

Details for d3oe7i_

PDB Entry: 3oe7 (more details), 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T
PDB Compounds: (I:) ATP synthase subunit epsilon

SCOPe Domain Sequences for d3oe7i_:

Sequence, based on SEQRES records: (download)

>d3oe7i_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpitk

Sequence, based on observed residues (ATOM records): (download)

>d3oe7i_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isyaaylnvaaqairstelqtasvlnrsqtdafytqyknaseptpitk

SCOPe Domain Coordinates for d3oe7i_:

Click to download the PDB-style file with coordinates for d3oe7i_.
(The format of our PDB-style files is described here.)

Timeline for d3oe7i_: