SCOPe 2.08: Domain d1xyab_: 1xya B:

Lineage for d1xyab_ (1xya B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.3: Xylose isomerase [51665] (2 proteins)

6. Protein D-xylose isomerase [51666] (13 species)

7. Species Streptomyces olivochromogenes [TaxId:1963] [51669] (9 PDB entries)

8. Domain d1xyab_: 1xya B: [29412]
   complexed with mg, oh

Details for d1xyab_

PDB Entry: 1xya, 1.81 Å

PDB Description: x-ray crystallographic structures of d-xylose isomerase-substrate complexes position the substrate and provide evidence for metal movement during catalysis

PDB Compounds: (B:) xylose isomerase

SCOPe Domain Sequences for d1xyab_:

Sequence; same for both SEQRES and ATOM records:

>d1xyab_ c.1.15.3 (B:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]}
syqptpedrftfglwtvgwqgrdpfgdatrpaldpvetvqrlaelgahgvtfhdddlipf
gssdtereshikrfrqaldatgmtvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaktyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtrfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqsgikydqdlrfgagdlraafwlvdllesagyegprhfdfkpprtedidgvwa
saagcmrnylilkeraaafradpevqealrasrldelaqptaadgvqelladrtafedfd
vdaaaargmaferldqlamdhllgar

Timeline for d1xyab_:

• d1xyab_ first appeared (with stable ids) in SCOP 1.55
  
• d1xyab_ appears in SCOPe 2.07