Lineage for d2gyia_ (2gyi A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2088890Family c.1.15.3: Xylose isomerase [51665] (2 protein domains)
  6. 2088891Protein D-xylose isomerase [51666] (13 species)
  7. 2089003Species Streptomyces olivochromogenes [TaxId:1963] [51669] (9 PDB entries)
  8. 2089007Domain d2gyia_: 2gyi A: [29409]
    complexed with hya, mg

Details for d2gyia_

PDB Entry: 2gyi (more details), 1.6 Å

PDB Description: design, synthesis, and characterization of a potent xylose isomerase inhibitor, d-threonohydroxamic acid, and high-resolution x-ray crystallographic structure of the enzyme-inhibitor complex
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d2gyia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyia_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]}
yqptpedrftfglwtvgwqgrdpfgdatrpaldpvetvqrlaelgahgvtfhdddlipfg
ssdtereshikrfrqaldatgmtvpmattnlfthpvfkdggftandrdvrryalrktirn
idlavelgaktyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydtrfaiep
kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
hidlngqsgikydqdlrfgagdlraafwlvdllesagyegprhfdfkpprtedidgvwas
aagcmrnylilkeraaafradpevqealrasrldelaqptaadgvqelladrtafedfdv
daaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d2gyia_:

Click to download the PDB-style file with coordinates for d2gyia_.
(The format of our PDB-style files is described here.)

Timeline for d2gyia_: