Lineage for d6xia__ (6xia -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386464Superfamily c.1.15: Xylose isomerase-like [51658] (5 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 386485Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 386486Protein D-xylose isomerase [51666] (12 species)
  7. 386589Species Streptomyces albus [TaxId:1888] [51667] (1 PDB entry)
  8. 386590Domain d6xia__: 6xia - [29406]

Details for d6xia__

PDB Entry: 6xia (more details), 1.65 Å

PDB Description: refinement of glucose isomerase from streptomyces albus at 1.65 angstroms with data from an imaging plate

SCOP Domain Sequences for d6xia__:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xia__ c.1.15.3 (-) D-xylose isomerase {Streptomyces albus}
nyqptpedrftfglwtvgwegrdpfgdatrtaldpvesvrrlaelgahgvtfhdddlipf
gssdseryehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllgarg

SCOP Domain Coordinates for d6xia__:

Click to download the PDB-style file with coordinates for d6xia__.
(The format of our PDB-style files is described here.)

Timeline for d6xia__: