Lineage for d3na1a_ (3na1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (54 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005605Domain d3na1a_: 3na1 A: [294013]
    Other proteins in same PDB: d3na1c_, d3na1d_
    automated match to d3k9va_
    complexed with fes, hcd, hem

Details for d3na1a_

PDB Entry: 3na1 (more details), 2.25 Å

PDB Description: Crystal structure of human CYP11A1 in complex with 20-hydroxycholesterol
PDB Compounds: (A:) Cholesterol side-chain cleavage enzyme, mitochondrial

SCOPe Domain Sequences for d3na1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3na1a_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sprpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvyvid
pedvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevmapea
tknflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqgmle
evvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiytqn
fywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhlyema
rnlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvndlv
lrdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvrqcl
grriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpfn

SCOPe Domain Coordinates for d3na1a_:

Click to download the PDB-style file with coordinates for d3na1a_.
(The format of our PDB-style files is described here.)

Timeline for d3na1a_:

  • d3na1a_ is new in SCOPe 2.06-stable