SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3na1a_ (3na1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (58 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005605Domain d3na1a_: 3na1 A: [294013]
    Other proteins in same PDB: d3na1c_, d3na1d_
    automated match to d3k9va_
    complexed with fes, hcd, hem

Details for d3na1a_

PDB Entry: 3na1 (more details), 2.25 Å

PDB Description: Crystal structure of human CYP11A1 in complex with 20-hydroxycholesterol
PDB Compounds: (A:) Cholesterol side-chain cleavage enzyme, mitochondrial

SCOPe Domain Sequences for d3na1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3na1a_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sprpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvyvid
pedvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevmapea
tknflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqgmle
evvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiytqn
fywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhlyema
rnlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvndlv
lrdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvrqcl
grriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpfn

SCOPe Domain Coordinates for d3na1a_:

Click to download the PDB-style file with coordinates for d3na1a_.
(The format of our PDB-style files is described here.)

Timeline for d3na1a_:

  • d3na1a_ is new in SCOPe 2.06-stable