![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (64 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries) |
![]() | Domain d3na0b_: 3na0 B: [294012] Other proteins in same PDB: d3na0c_, d3na0d_ automated match to d3k9va_ complexed with 2dc, fes, hem |
PDB Entry: 3na0 (more details), 2.5 Å
SCOPe Domain Sequences for d3na0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3na0b_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} prpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvyvidp edvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevmapeat knflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqgmlee vvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiytqnf ywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhlyemar nlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvndlvl rdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvrqclg rriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpf
Timeline for d3na0b_: