Lineage for d3n9ya_ (3n9y A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005607Domain d3n9ya_: 3n9y A: [294007]
    Other proteins in same PDB: d3n9yc_, d3n9yd_
    automated match to d3k9va_
    complexed with clr, fes, hem

Details for d3n9ya_

PDB Entry: 3n9y (more details), 2.1 Å

PDB Description: crystal structure of human cyp11a1 in complex with cholesterol
PDB Compounds: (A:) Cholesterol side-chain cleavage enzyme

SCOPe Domain Sequences for d3n9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n9ya_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sprpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvyvid
pedvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevmapea
tknflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqgmle
evvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiytqn
fywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhlyema
rnlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvndlv
lrdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvrqcl
grriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpf

SCOPe Domain Coordinates for d3n9ya_:

Click to download the PDB-style file with coordinates for d3n9ya_.
(The format of our PDB-style files is described here.)

Timeline for d3n9ya_:

  • d3n9ya_ is new in SCOPe 2.06-stable