Lineage for d1d8wd_ (1d8w D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2088857Family c.1.15.2: L-rhamnose isomerase [51662] (2 protein domains)
    automatically mapped to Pfam PF06134
  6. 2088858Protein L-rhamnose isomerase [51663] (1 species)
  7. 2088859Species Escherichia coli [TaxId:562] [51664] (3 PDB entries)
  8. 2088863Domain d1d8wd_: 1d8w D: [29397]
    complexed with zn

Details for d1d8wd_

PDB Entry: 1d8w (more details), 1.6 Å

PDB Description: l-rhamnose isomerase
PDB Compounds: (D:) l-rhamnose isomerase

SCOPe Domain Sequences for d1d8wd_:

Sequence, based on SEQRES records: (download)

>d1d8wd_ c.1.15.2 (D:) L-rhamnose isomerase {Escherichia coli [TaxId: 562]}
mttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpegsltggiq
atgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwve
wakanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtps
vmniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgigaesytvg
snefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvl
lddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallralleptael
rkleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr

Sequence, based on observed residues (ATOM records): (download)

>d1d8wd_ c.1.15.2 (D:) L-rhamnose isomerase {Escherichia coli [TaxId: 562]}
mttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfeypgkarnasel
radleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewakanqlgldfnpsc
fshplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvmniwipdgmkditv
drlaprqrllaaldeviseklnpahhidavesklfgigaesytvgsnefymgyatsrqta
lcldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvllddetqaiaseivrh
dlfdrvhigldffdasinriaawvigtrnmkkallralleptaelrkleapgdytarlal
leeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr

SCOPe Domain Coordinates for d1d8wd_:

Click to download the PDB-style file with coordinates for d1d8wd_.
(The format of our PDB-style files is described here.)

Timeline for d1d8wd_: