Lineage for d1d8wb_ (1d8w B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19614Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) (S)
  5. 19620Family c.1.15.2: L-rhamnose isomerase [51662] (1 protein)
  6. 19621Protein L-rhamnose isomerase [51663] (1 species)
  7. 19622Species Escherichia coli [TaxId:562] [51664] (3 PDB entries)
  8. 19624Domain d1d8wb_: 1d8w B: [29395]

Details for d1d8wb_

PDB Entry: 1d8w (more details), 1.6 Å

PDB Description: l-rhamnose isomerase

SCOP Domain Sequences for d1d8wb_:

Sequence, based on SEQRES records: (download)

>d1d8wb_ c.1.15.2 (B:) L-rhamnose isomerase {Escherichia coli}
ttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpegsltggiqa
tgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvew
akanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsv
mniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgigaesytvgs
nefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvll
ddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallralleptaelr
kleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr

Sequence, based on observed residues (ATOM records): (download)

>d1d8wb_ c.1.15.2 (B:) L-rhamnose isomerase {Escherichia coli}
ttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfeypgkarnaselr
adleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewakanqlgldfnpscf
shplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvmniwipdgmkditvd
rlaprqrllaaldeviseklnpahhidavesklfgigaesytvgsnefymgyatsrqtal
cldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvllddetqaiaseivrhd
lfdrvhigldffdasinriaawvigtrnmkkallralleptaelrkleapgdytarlall
eeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr

SCOP Domain Coordinates for d1d8wb_:

Click to download the PDB-style file with coordinates for d1d8wb_.
(The format of our PDB-style files is described here.)

Timeline for d1d8wb_: