SCOP 1.75: Domain d9rubb1: 9rub B:138-459

Lineage for d9rubb1 (9rub B:138-459)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family)

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
   N-terminal domain is alpha+beta

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [51657] (5 PDB entries)

8. Domain d9rubb1: 9rub B:138-459 [29387]
   Other proteins in same PDB: d9ruba2, d9rubb2
   complexed with cbx, mg, rub

Details for d9rubb1

PDB Entry: 9rub, 2.6 Å

PDB Description: crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate

PDB Compounds: (B:) ribulose-1,5-bisphosphate carboxylase

SCOP Domain Sequences for d9rubb1:

Sequence; same for both SEQRES and ATOM records:

>d9rubb1 c.1.14.1 (B:138-459) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmp
gffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelaraf
esfpgdadqiypgwrkalgved

Timeline for d9rubb1:

• d9rubb1 first appeared (with stable ids) in SCOP 1.55
  
• d9rubb1 appears in SCOP 1.73
  
• d9rubb1 appears in SCOPe 2.01
  
• d9rubb1 appears in the current release, SCOPe 2.08