Lineage for d9rubb1 (9rub B:138-459)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237666Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 237667Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 237668Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 237706Species Rhodospirillum rubrum [TaxId:1085] [51657] (5 PDB entries)
  8. 237712Domain d9rubb1: 9rub B:138-459 [29387]
    Other proteins in same PDB: d9ruba2, d9rubb2
    complexed with cbx, mg, rub

Details for d9rubb1

PDB Entry: 9rub (more details), 2.6 Å

PDB Description: crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate

SCOP Domain Sequences for d9rubb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9rubb1 c.1.14.1 (B:138-459) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmp
gffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelaraf
esfpgdadqiypgwrkalgved

SCOP Domain Coordinates for d9rubb1:

Click to download the PDB-style file with coordinates for d9rubb1.
(The format of our PDB-style files is described here.)

Timeline for d9rubb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d9rubb2