SCOPe 2.05: Domain d9ruba1: 9rub A:138-460

Lineage for d9ruba1 (9rub A:138-460)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [51657] (5 PDB entries)

8. Domain d9ruba1: 9rub A:138-460 [29386]
   Other proteins in same PDB: d9ruba2, d9rubb2
   complexed with fmt, mg, rub

Details for d9ruba1

PDB Entry: 9rub, 2.6 Å

PDB Description: crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate

PDB Compounds: (A:) ribulose-1,5-bisphosphate carboxylase

SCOPe Domain Sequences for d9ruba1:

Sequence; same for both SEQRES and ATOM records:

>d9ruba1 c.1.14.1 (A:138-460) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmp
gffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelaraf
esfpgdadqiypgwrkalgvedt

Timeline for d9ruba1:

• d9ruba1 first appeared (with stable ids) in SCOP 1.55
  
• d9ruba1 appears in SCOPe 2.04
  
• d9ruba1 appears in SCOPe 2.06
  
• d9ruba1 appears in the current release, SCOPe 2.08