Lineage for d2rusb1 (2rus B:138-457)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19539Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 19540Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 19541Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species)
  7. 19552Species Rhodospirillum rubrum [TaxId:1085] [51657] (5 PDB entries)
  8. 19556Domain d2rusb1: 2rus B:138-457 [29385]
    Other proteins in same PDB: d2rusa2, d2rusb2

Details for d2rusb1

PDB Entry: 2rus (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex of ribulose-1,5-bisphosphate carboxylase, mg(ii), and activator co2 at 2.3-angstroms resolution

SCOP Domain Sequences for d2rusb1:

Sequence, based on SEQRES records: (download)

>d2rusb1 c.1.14.1 (B:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmp
gffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelaraf
esfpgdadqiypgwrkalgv

Sequence, based on observed residues (ATOM records): (download)

>d2rusb1 c.1.14.1 (B:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtmgfgkgessdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgf
fenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafes
fpgdadqiypgwrkalgv

SCOP Domain Coordinates for d2rusb1:

Click to download the PDB-style file with coordinates for d2rusb1.
(The format of our PDB-style files is described here.)

Timeline for d2rusb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rusb2