Lineage for d2rusa1 (2rus A:138-457)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088462Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 2088536Species Rhodospirillum rubrum [TaxId:1085] [51657] (5 PDB entries)
  8. 2088539Domain d2rusa1: 2rus A:138-457 [29384]
    Other proteins in same PDB: d2rusa2, d2rusb2
    complexed with for, mg

Details for d2rusa1

PDB Entry: 2rus (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex of ribulose-1,5-bisphosphate carboxylase, mg(ii), and activator co2 at 2.3-angstroms resolution
PDB Compounds: (A:) rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)

SCOPe Domain Sequences for d2rusa1:

Sequence, based on SEQRES records: (download)

>d2rusa1 c.1.14.1 (A:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmp
gffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelaraf
esfpgdadqiypgwrkalgv

Sequence, based on observed residues (ATOM records): (download)

>d2rusa1 c.1.14.1 (A:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtsdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlgnan
viltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgdadqi
ypgwrkalgv

SCOPe Domain Coordinates for d2rusa1:

Click to download the PDB-style file with coordinates for d2rusa1.
(The format of our PDB-style files is described here.)

Timeline for d2rusa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rusa2