Lineage for d1rsca1 (1rsc A:148-475)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19539Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 19540Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 19541Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species)
  7. 19601Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [51656] (2 PDB entries)
  8. 19603Domain d1rsca1: 1rsc A:148-475 [29381]
    Other proteins in same PDB: d1rsca2, d1rscm_

Details for d1rsca1

PDB Entry: 1rsc (more details), 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate

SCOP Domain Sequences for d1rsca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsca1 c.1.14.1 (A:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301}
fqgpphgiqverdllnkygrpmlgctikpklglsaknygravyeclrggldftkddenin
sqpfqrwrdrflfvadaihksqaetgeikghylnvtaptceemmkraefakelgmpiimh
dfltagftanttlakwcrdngvllhihramhavidrqrnhgihfrvlakclrlsggdhlh
sgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdwasmpgvlpvasggihvwhm
palveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrdlyreggdilre
agkwspelaaaldlwkeikfefetmdkl

SCOP Domain Coordinates for d1rsca1:

Click to download the PDB-style file with coordinates for d1rsca1.
(The format of our PDB-style files is described here.)

Timeline for d1rsca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rsca2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rscm_