Lineage for d1rbla1 (1rbl A:148-475)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307292Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 307293Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 307294Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 307389Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [51656] (2 PDB entries)
  8. 307390Domain d1rbla1: 1rbl A:148-475 [29380]
    Other proteins in same PDB: d1rbla2, d1rblm_
    complexed with cap, cbx, mg

Details for d1rbla1

PDB Entry: 1rbl (more details), 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301

SCOP Domain Sequences for d1rbla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbla1 c.1.14.1 (A:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301}
fqgpphgiqverdllnkygrpmlgctikpklglsaknygravyeclrggldftkddenin
sqpfqrwrdrflfvadaihksqaetgeikghylnvtaptceemmkraefakelgmpiimh
dfltagftanttlakwcrdngvllhihramhavidrqrnhgihfrvlakclrlsggdhlh
sgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdwasmpgvlpvasggihvwhm
palveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrdlyreggdilre
agkwspelaaaldlwkeikfefetmdkl

SCOP Domain Coordinates for d1rbla1:

Click to download the PDB-style file with coordinates for d1rbla1.
(The format of our PDB-style files is described here.)

Timeline for d1rbla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rbla2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rblm_