Lineage for d1bxng1 (1bxn G:151-467)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1149523Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 1149524Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 1149525Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 1149526Species Alcaligenes eutrophus [TaxId:106590] [51655] (1 PDB entry)
  8. 1149530Domain d1bxng1: 1bxn G:151-467 [29379]
    Other proteins in same PDB: d1bxna2, d1bxnc2, d1bxne2, d1bxng2, d1bxni_, d1bxnj_, d1bxnk_, d1bxnl_
    complexed with po4

Details for d1bxng1

PDB Entry: 1bxn (more details), 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.
PDB Compounds: (G:) protein (ribulose bisphosphate carboxylase large chain)

SCOPe Domain Sequences for d1bxng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxng1 c.1.14.1 (G:151-467) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus [TaxId: 106590]}
fagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldfmkddenin
sqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefakslgsviimv
dlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrlagvdhmht
gtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasggihagqmh
qlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilnegpeilrda
arwcgplraaldtwgdi

SCOPe Domain Coordinates for d1bxng1:

Click to download the PDB-style file with coordinates for d1bxng1.
(The format of our PDB-style files is described here.)

Timeline for d1bxng1: