Lineage for d1bxne1 (1bxn E:151-467)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) 
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein) Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species) 
Species Alcaligenes eutrophus [TaxId:106590] [51655] (1 PDB entry) 
Domain d1bxne1: 1bxn E:151-467 [29378]
Other proteins in same PDB: d1bxna2, d1bxnc2, d1bxne2, d1bxng2, d1bxni_, d1bxnj_, d1bxnk_, d1bxnl_
Details for d1bxne1
PDB Entry: 1bxn (more details), 2.7 Å
PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.
SCOP Domain Sequences for d1bxne1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxne1 c.1.14.1 (E:151-467) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus}
fagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldfmkddenin
sqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefakslgsviimv
dlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrlagvdhmht
gtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasggihagqmh
qlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilnegpeilrda
arwcgplraaldtwgdi
SCOP Domain Coordinates for d1bxne1:
Click to download the PDB-style file with coordinates for d1bxne1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bxne1:
View in 3D
