SCOPe 2.08: Domain d3mhsb_: 3mhs B:

Lineage for d3mhsb_ (3mhs B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.301: Sus1-like [310571] (1 superfamily)
   5 helices; articulated hairpin fold

4. Superfamily a.301.1: Sus1-like [310603] (1 family)
   Pfam PF10163
   interactions with Sac3, Cdc31 described in PubMed 19328066

5. Family a.301.1.1: Sus1-like [310653] (3 proteins)

6. Protein Sus1 [310814] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (14 PDB entries)

8. Domain d3mhsb_: 3mhs B: [293774]
   Other proteins in same PDB: d3mhsd_
   automated match to d3fwbc_
   complexed with edo, gol, zn

Details for d3mhsb_

PDB Entry: 3mhs, 1.89 Å

PDB Description: Structure of the SAGA Ubp8/Sgf11/Sus1/Sgf73 DUB module bound to ubiquitin aldehyde

PDB Compounds: (B:) Protein SUS1

SCOPe Domain Sequences for d3mhsb_:

Sequence; same for both SEQRES and ATOM records:

>d3mhsb_ a.301.1.1 (B:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
taqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilst
vepkalemvsdstretvlkqirefleeivdt

Timeline for d3mhsb_:

• d3mhsb_ first appeared in SCOPe 2.06
  
• d3mhsb_ appears in SCOPe 2.07