Lineage for d1bwvg1 (1bwv G:150-478)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) 
automatically mapped to Pfam PF00016Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
N-terminal domain is alpha+betaProtein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species) 
Species Galdieria partita [TaxId:83374] [51654] (2 PDB entries) 
Domain d1bwvg1: 1bwv G:150-478 [29375]
Other proteins in same PDB: d1bwva2, d1bwvc2, d1bwve2, d1bwvg2, d1bwvs_, d1bwvu_, d1bwvw_, d1bwvy_
complexed with cap, mg
Details for d1bwvg1
PDB Entry: 1bwv (more details), 2.4 Å
PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate
PDB Compounds: (G:) protein (ribulose bisphosphate carboxylase)SCOPe Domain Sequences for d1bwvg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwvg1 c.1.14.1 (G:150-478) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
gpatgvilererldkfgrpllgcttkpklglsgknygrvvyealkggldfvkddeninsq
pfmrwrerylftmeavnkasaatgevkghylnvtaatmeemyaranfakelgsviimidl
vigytaiqtmakwardndmilhlhragnstysrqknhgmnfrvickwmrmagvdhihagt
vvgklegdpiitrgfyktlllpklernlqeglffdmewaslrkvmpvasggihagqmhql
ihylgedvvlqfgggtighpdgiqagatanrvaleamilarnenrdyltegpeilreaak
tcgalrtaldlwkditfnytstdtsdfv
SCOPe Domain Coordinates for d1bwvg1:
Click to download the PDB-style file with coordinates for d1bwvg1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bwvg1:
View in 3D
