Lineage for d1bwva1 (1bwv A:150-478)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65680Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 65681Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 65682Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species)
  7. 65688Species Galdieria partita [TaxId:83374] [51654] (1 PDB entry)
  8. 65689Domain d1bwva1: 1bwv A:150-478 [29372]
    Other proteins in same PDB: d1bwva2, d1bwvc2, d1bwve2, d1bwvg2, d1bwvs_, d1bwvu_, d1bwvw_, d1bwvy_

Details for d1bwva1

PDB Entry: 1bwv (more details), 2.4 Å

PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate

SCOP Domain Sequences for d1bwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwva1 c.1.14.1 (A:150-478) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita}
gpatgvilererldkfgrpllgcttkpklglsgknygrvvyealkggldfvkddeninsq
pfmrwrerylftmeavnkasaatgevkghylnvtaatmeemyaranfakelgsviimidl
vigytaiqtmakwardndmilhlhragnstysrqknhgmnfrvickwmrmagvdhihagt
vvgklegdpiitrgfyktlllpklernlqeglffdmewaslrkvmpvasggihagqmhql
ihylgedvvlqfgggtighpdgiqagatanrvaleamilarnenrdyltegpeilreaak
tcgalrtaldlwkditfnytstdtsdfv

SCOP Domain Coordinates for d1bwva1:

Click to download the PDB-style file with coordinates for d1bwva1.
(The format of our PDB-style files is described here.)

Timeline for d1bwva1: