Lineage for d1bwva1 (1bwv A:150-478)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838512Species Galdieria partita [TaxId:83374] [51654] (2 PDB entries)
  8. 2838513Domain d1bwva1: 1bwv A:150-478 [29372]
    Other proteins in same PDB: d1bwva2, d1bwvc2, d1bwve2, d1bwvg2, d1bwvs_, d1bwvu_, d1bwvw_, d1bwvy_
    complexed with cap, mg

Details for d1bwva1

PDB Entry: 1bwv (more details), 2.4 Å

PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate
PDB Compounds: (A:) protein (ribulose bisphosphate carboxylase)

SCOPe Domain Sequences for d1bwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwva1 c.1.14.1 (A:150-478) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
gpatgvilererldkfgrpllgcttkpklglsgknygrvvyealkggldfvkddeninsq
pfmrwrerylftmeavnkasaatgevkghylnvtaatmeemyaranfakelgsviimidl
vigytaiqtmakwardndmilhlhragnstysrqknhgmnfrvickwmrmagvdhihagt
vvgklegdpiitrgfyktlllpklernlqeglffdmewaslrkvmpvasggihagqmhql
ihylgedvvlqfgggtighpdgiqagatanrvaleamilarnenrdyltegpeilreaak
tcgalrtaldlwkditfnytstdtsdfv

SCOPe Domain Coordinates for d1bwva1:

Click to download the PDB-style file with coordinates for d1bwva1.
(The format of our PDB-style files is described here.)

Timeline for d1bwva1: