Lineage for d1rcxr1 (1rcx R:148-475)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838627Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (11 PDB entries)
  8. 2838674Domain d1rcxr1: 1rcx R:148-475 [29370]
    Other proteins in same PDB: d1rcxb2, d1rcxc_, d1rcxe2, d1rcxf_, d1rcxh2, d1rcxi_, d1rcxk2, d1rcxl2, d1rcxm_, d1rcxo2, d1rcxp_, d1rcxr2, d1rcxs_, d1rcxt_, d1rcxv2, d1rcxw_
    complexed with rub

Details for d1rcxr1

PDB Entry: 1rcx (more details), 2.4 Å

PDB Description: non-activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate
PDB Compounds: (R:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rcxr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcxr1 c.1.14.1 (R:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOPe Domain Coordinates for d1rcxr1:

Click to download the PDB-style file with coordinates for d1rcxr1.
(The format of our PDB-style files is described here.)

Timeline for d1rcxr1: