Lineage for d1rcoe1 (1rco E:148-475)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685056Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 685057Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 685058Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 685168Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
  8. 685194Domain d1rcoe1: 1rco E:148-475 [29358]
    Other proteins in same PDB: d1rcob2, d1rcoc_, d1rcoe2, d1rcof_, d1rcoh2, d1rcoi_, d1rcok2, d1rcol2, d1rcom_, d1rcoo2, d1rcop_, d1rcor2, d1rcos_, d1rcot_, d1rcov2, d1rcow_

Details for d1rcoe1

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate
PDB Compounds: (E:) ribulose bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d1rcoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcoe1 c.1.14.1 (E:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOP Domain Coordinates for d1rcoe1:

Click to download the PDB-style file with coordinates for d1rcoe1.
(The format of our PDB-style files is described here.)

Timeline for d1rcoe1: