Lineage for d1rxoh1 (1rxo H:148-463)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386354Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 386355Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 386356Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 386413Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
  8. 386433Domain d1rxoh1: 1rxo H:148-463 [29354]
    Other proteins in same PDB: d1rxob2, d1rxoc_, d1rxoe2, d1rxof_, d1rxoh2, d1rxoi_, d1rxol2, d1rxos_
    complexed with ca, rub

Details for d1rxoh1

PDB Entry: 1rxo (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium

SCOP Domain Sequences for d1rxoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxoh1 c.1.14.1 (H:148-463) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwk

SCOP Domain Coordinates for d1rxoh1:

Click to download the PDB-style file with coordinates for d1rxoh1.
(The format of our PDB-style files is described here.)

Timeline for d1rxoh1: