Lineage for d1rxoe1 (1rxo E:148-463)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65680Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 65681Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 65682Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species)
  7. 65704Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
  8. 65722Domain d1rxoe1: 1rxo E:148-463 [29353]
    Other proteins in same PDB: d1rxob2, d1rxoc_, d1rxoe2, d1rxof_, d1rxoh2, d1rxoi_, d1rxol2, d1rxos_

Details for d1rxoe1

PDB Entry: 1rxo (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium

SCOP Domain Sequences for d1rxoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxoe1 c.1.14.1 (E:148-463) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwk

SCOP Domain Coordinates for d1rxoe1:

Click to download the PDB-style file with coordinates for d1rxoe1.
(The format of our PDB-style files is described here.)

Timeline for d1rxoe1: