Lineage for d1rxob1 (1rxo B:148-463)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838627Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (11 PDB entries)
  8. 2838644Domain d1rxob1: 1rxo B:148-463 [29352]
    Other proteins in same PDB: d1rxob2, d1rxoc_, d1rxoe2, d1rxof_, d1rxoh2, d1rxoi_, d1rxol2, d1rxos_
    complexed with ca, rub

Details for d1rxob1

PDB Entry: 1rxo (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium
PDB Compounds: (B:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rxob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxob1 c.1.14.1 (B:148-463) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwk

SCOPe Domain Coordinates for d1rxob1:

Click to download the PDB-style file with coordinates for d1rxob1.
(The format of our PDB-style files is described here.)

Timeline for d1rxob1: