Lineage for d1rbol1 (1rbo L:148-475)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307292Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 307293Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 307294Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 307351Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
  8. 307363Domain d1rbol1: 1rbo L:148-475 [29343]
    Other proteins in same PDB: d1rbob2, d1rboc_, d1rboe2, d1rbof_, d1rboh2, d1rboi_, d1rbol2, d1rbos_

Details for d1rbol1

PDB Entry: 1rbo (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate

SCOP Domain Sequences for d1rbol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbol1 c.1.14.1 (L:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOP Domain Coordinates for d1rbol1:

Click to download the PDB-style file with coordinates for d1rbol1.
(The format of our PDB-style files is described here.)

Timeline for d1rbol1: