SCOP 1.65: Domain d4rubc1: 4rub C:148-473

Lineage for d4rubc1 (4rub C:148-473)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family)
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
N-terminal domain is alpha+beta
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [51652] (5 PDB entries)
Domain d4rubc1: 4rub C:148-473 [29333]
Other proteins in same PDB: d4ruba2, d4rubb2, d4rubc2, d4rubd2, d4rubs_, d4rubt_, d4rubu_, d4rubv_

Details for d4rubc1

PDB Entry: 4rub (more details), 2.7 Å

PDB Description: a crystal form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from nicotiana tabacum in the activated state

SCOP Domain Sequences for d4rubc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rubc1 c.1.14.1 (C:148-473) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivmh
dyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhih
sgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiire
ackwspelaaacevwkeivfnfaavd

SCOP Domain Coordinates for d4rubc1:

Click to download the PDB-style file with coordinates for d4rubc1.
(The format of our PDB-style files is described here.)

Timeline for d4rubc1: