Lineage for d4ruba1 (4rub A:148-473)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838720Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [51652] (5 PDB entries)
  8. 2838726Domain d4ruba1: 4rub A:148-473 [29331]
    Other proteins in same PDB: d4ruba2, d4rubb2, d4rubc2, d4rubd2, d4rubs_, d4rubt_, d4rubu_, d4rubv_
    complexed with cap, fmt, mg

Details for d4ruba1

PDB Entry: 4rub (more details), 2.7 Å

PDB Description: a crystal form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from nicotiana tabacum in the activated state
PDB Compounds: (A:) ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)

SCOPe Domain Sequences for d4ruba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ruba1 c.1.14.1 (A:148-473) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivmh
dyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhih
sgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiire
ackwspelaaacevwkeivfnfaavd

SCOPe Domain Coordinates for d4ruba1:

Click to download the PDB-style file with coordinates for d4ruba1.
(The format of our PDB-style files is described here.)

Timeline for d4ruba1: