Lineage for d1rlcl1 (1rlc L:148-467)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237666Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 237667Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 237668Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 237758Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [51652] (5 PDB entries)
  8. 237763Domain d1rlcl1: 1rlc L:148-467 [29330]
    Other proteins in same PDB: d1rlcl2, d1rlcs_
    complexed with cap

Details for d1rlcl1

PDB Entry: 1rlc (more details), 2.7 Å

PDB Description: crystal structure of the unactivated ribulose 1, 5-bisphosphate carboxylase(slash)oxygenase complexed with a transition state analog, 2-carboxy-d-arabinitol 1,5-bisphosphate

SCOP Domain Sequences for d1rlcl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlcl1 c.1.14.1 (L:148-467) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivmh
dyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhih
sgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiire
ackwspelaaacevwkeivf

SCOP Domain Coordinates for d1rlcl1:

Click to download the PDB-style file with coordinates for d1rlcl1.
(The format of our PDB-style files is described here.)

Timeline for d1rlcl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlcl2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rlcs_