Lineage for d1rlda1 (1rld A:148-467)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19539Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 19540Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 19541Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species)
  7. 19604Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [51652] (5 PDB entries)
  8. 19607Domain d1rlda1: 1rld A:148-467 [29328]
    Other proteins in same PDB: d1rlda2, d1rldb2, d1rlds_, d1rldt_

Details for d1rlda1

PDB Entry: 1rld (more details), 2.5 Å

PDB Description: solid-state phase transition in the crystal structure of ribulose 1,5-biphosphate carboxylase(slash)oxygenase
PDB Compounds: (A:)

SCOP Domain Sequences for d1rlda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlda1 c.1.14.1 (A:148-467) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaeaetgeikghylnatagtceemikravfarelgvpivmh
dyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhih
sgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiire
ackwspelaaacevwkeivf

SCOP Domain Coordinates for d1rlda1:

Click to download the PDB-style file with coordinates for d1rlda1.
(The format of our PDB-style files is described here.)

Timeline for d1rlda1: