Lineage for d3rubl1 (3rub L:148-467)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386354Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 386355Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 386356Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 386454Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [51652] (5 PDB entries)
  8. 386455Domain d3rubl1: 3rub L:148-467 [29326]
    Other proteins in same PDB: d3rubl2, d3rubs_
    complexed with so4

Details for d3rubl1

PDB Entry: 3rub (more details), 2 Å

PDB Description: crystal structure of the unactivated form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from tobacco refined at 2.0-angstroms resolution

SCOP Domain Sequences for d3rubl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rubl1 c.1.14.1 (L:148-467) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivmh
dyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhih
sgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwhm
palteifgddsvlqfggmtlghpwgnapgavanrvaleacvkarnegrdlaqegneiire
ackwspelaaacevwkeivf

SCOP Domain Coordinates for d3rubl1:

Click to download the PDB-style file with coordinates for d3rubl1.
(The format of our PDB-style files is described here.)

Timeline for d3rubl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rubl2
View in 3D
Domains from other chains:
(mouse over for more information)
d3rubs_