Lineage for d1f8mc_ (1f8m C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838112Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 2838136Protein Isocitrate lyase [51642] (5 species)
    elaborated with additional subdomains
  7. 2838144Species Mycobacterium tuberculosis [TaxId:1773] [51644] (3 PDB entries)
  8. 2838147Domain d1f8mc_: 1f8m C: [29317]
    complexed with mg, pyr
    has additional subdomain(s) that are not in the common domain

Details for d1f8mc_

PDB Entry: 1f8m (more details), 1.8 Å

PDB Description: crystal structure of 3-bromopyruvate modified isocitrate lyase (icl) from mycobacterium tuberculosis
PDB Compounds: (C:) isocitrate lyase

SCOPe Domain Sequences for d1f8mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8mc_ c.1.12.7 (C:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]}
asvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
steegqf

SCOPe Domain Coordinates for d1f8mc_:

Click to download the PDB-style file with coordinates for d1f8mc_.
(The format of our PDB-style files is described here.)

Timeline for d1f8mc_: