Lineage for d1pymb_ (1pym B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19439Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 19507Family c.1.12.4: Phosphoenolpyruvate mutase [51635] (1 protein)
  6. 19508Protein Phosphoenolpyruvate mutase [51636] (1 species)
  7. 19509Species Blue mussel (Mytilus edulis) [TaxId:6550] [51637] (1 PDB entry)
  8. 19511Domain d1pymb_: 1pym B: [29309]

Details for d1pymb_

PDB Entry: 1pym (more details), 1.8 Å

PDB Description: phosphoenolpyruvate mutase from mollusk in with bound mg2-oxalate

SCOP Domain Sequences for d1pymb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pymb_ c.1.12.4 (B:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis)}
vkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneasw
tqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktnsl
hdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnaga
dailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlra
svsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylp

SCOP Domain Coordinates for d1pymb_:

Click to download the PDB-style file with coordinates for d1pymb_.
(The format of our PDB-style files is described here.)

Timeline for d1pymb_: