Lineage for d1pyma_ (1pym A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838112Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 2838191Protein Phosphoenolpyruvate mutase [51636] (1 species)
  7. 2838192Species Blue mussel (Mytilus edulis) [TaxId:6550] [51637] (6 PDB entries)
  8. 2838204Domain d1pyma_: 1pym A: [29308]
    complexed with mg, oxl

Details for d1pyma_

PDB Entry: 1pym (more details), 1.8 Å

PDB Description: phosphoenolpyruvate mutase from mollusk in with bound mg2-oxalate
PDB Compounds: (A:) protein (phosphoenolpyruvate mutase)

SCOPe Domain Sequences for d1pyma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyma_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]}
vkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneasw
tqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktnsl
hdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnaga
dailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlra
svsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn

SCOPe Domain Coordinates for d1pyma_:

Click to download the PDB-style file with coordinates for d1pyma_.
(The format of our PDB-style files is described here.)

Timeline for d1pyma_: