Lineage for d1fiy__ (1fiy -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573147Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 573249Family c.1.12.3: Phosphoenolpyruvate carboxylase [51632] (1 protein)
  6. 573250Protein Phosphoenolpyruvate carboxylase [51633] (1 species)
    the common fold is decorated with many additional helices
  7. 573251Species Escherichia coli [TaxId:562] [51634] (4 PDB entries)
  8. 573254Domain d1fiy__: 1fiy - [29307]

Details for d1fiy__

PDB Entry: 1fiy (more details), 2.8 Å

PDB Description: three-dimensional structure of phosphoenolpyruvate carboxylase from escherichia coli at 2.8 a resolution

SCOP Domain Sequences for d1fiy__:

Sequence, based on SEQRES records: (download)

>d1fiy__ c.1.12.3 (-) Phosphoenolpyruvate carboxylase {Escherichia coli}
qysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnl
sndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtik
kaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqlia
qswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvefvpv
rftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpellalv
geegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacyqsl
qacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyeswse
adkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv
lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysd
sakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgs
lkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdelsvi
scdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpakrrptggveslraipwifawtq
nrlmlpawlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlaeyyd
qrlvdkalwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdplnvlq
aellhrsrqaekegqepdprveqalmvtiagiaagmrntg

Sequence, based on observed residues (ATOM records): (download)

>d1fiy__ c.1.12.3 (-) Phosphoenolpyruvate carboxylase {Escherichia coli}
qysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnl
sndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtik
kaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqlia
qswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvefvpv
rftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpellalv
geegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacyqsl
qacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyeswse
adkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv
lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysd
sakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgs
lkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdelsvi
scdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpaveslraipwifawtqnrlmlpa
wlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlaeyydqrlvdka
lwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdplnvlqaellhrs
rqaekegqepdprveqalmvtiagiaagmrntg

SCOP Domain Coordinates for d1fiy__:

Click to download the PDB-style file with coordinates for d1fiy__.
(The format of our PDB-style files is described here.)

Timeline for d1fiy__: