Lineage for d1ggoa1 (1ggo A:510-874)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838066Family c.1.12.2: Pyruvate phosphate dikinase, C-terminal domain [51629] (1 protein)
    automatically mapped to Pfam PF02896
  6. 2838067Protein Pyruvate phosphate dikinase, C-terminal domain [51630] (3 species)
  7. 2838068Species Clostridium symbiosum [TaxId:1512] [51631] (7 PDB entries)
  8. 2838073Domain d1ggoa1: 1ggo A:510-874 [29305]
    Other proteins in same PDB: d1ggoa2, d1ggoa3
    complexed with so4; mutant

Details for d1ggoa1

PDB Entry: 1ggo (more details), 2.6 Å

PDB Description: t453a mutant of pyruvate, phosphate dikinase
PDB Compounds: (A:) protein (pyruvate, phosphate dikinase)

SCOPe Domain Sequences for d1ggoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggoa1 c.1.12.2 (A:510-874) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum [TaxId: 1512]}
ietqeasvsgsferimvwadkfrtlkvrtnadtpedtlnavklgaegiglcrtehmffea
drimkirkmilsdsveareealnelipfqkgdfkamykalegrpmtvryldpplhefvph
teeeqaelaknmgltlaevkakvdelhefnpmmghrgcrlavtypeiakmqtravmeaai
evkeetgidivpeimiplvgekkelkfvkdvvvevaeqvkkekgsdmqyhigtmieipra
altadaiaeeaeffsfgtndltqmtfgfsrddagkfldsyykakiyesdpfarldqtgvg
qlvemavkkgrqtrpglkcgicgehggdpssvefchkvglnyvscspfrvpiarlaaaqa
alnnk

SCOPe Domain Coordinates for d1ggoa1:

Click to download the PDB-style file with coordinates for d1ggoa1.
(The format of our PDB-style files is described here.)

Timeline for d1ggoa1: