Lineage for d1dik_1 (1dik 510-874)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117377Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 117451Family c.1.12.2: Pyruvate phosphate dikinase, C-terminal domain [51629] (1 protein)
  6. 117452Protein Pyruvate phosphate dikinase, C-terminal domain [51630] (1 species)
  7. 117453Species Clostridium symbiosum [TaxId:1512] [51631] (6 PDB entries)
  8. 117456Domain d1dik_1: 1dik 510-874 [29304]
    Other proteins in same PDB: d1dik_2, d1dik_3

Details for d1dik_1

PDB Entry: 1dik (more details), 2.3 Å

PDB Description: pyruvate phosphate dikinase

SCOP Domain Sequences for d1dik_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dik_1 c.1.12.2 (510-874) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum}
ietqeasvsgsferimvwadkfrtlkvrtnadtpedtlnavklgaegiglcrtehmffea
drimkirkmilsdsveareealnelipfqkgdfkamykalegrpmtvryldpplhefvph
teeeqaelaknmgltlaevkakvdelhefnpmmghrgcrlavtypeiakmqtravmeaai
evkeetgidivpeimiplvgekkelkfvkdvvvevaeqvkkekgsdmqyhigtmieipra
altadaiaeeaeffsfgtndltqmtfgfsrddagkfldsyykakiyesdpfarldqtgvg
qlvemavkkgrqtrpglkcgicgehggdpssvefchkvglnyvscspfrvpiarlaaaqa
alnnk

SCOP Domain Coordinates for d1dik_1:

Click to download the PDB-style file with coordinates for d1dik_1.
(The format of our PDB-style files is described here.)

Timeline for d1dik_1: